Protein Info for ABID97_RS22320 in Variovorax sp. OAS795

Annotation: glyoxylate carboligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01504: glyoxylate carboligase" amino acids 2 to 592 (591 residues), 1161 bits, see alignment E=0 PF02776: TPP_enzyme_N" amino acids 4 to 121 (118 residues), 108.3 bits, see alignment E=3.1e-35 PF00205: TPP_enzyme_M" amino acids 193 to 328 (136 residues), 131.6 bits, see alignment E=2.5e-42 PF02775: TPP_enzyme_C" amino acids 393 to 557 (165 residues), 119.9 bits, see alignment E=1.3e-38

Best Hits

Swiss-Prot: 75% identical to GCL_ECO57: Glyoxylate carboligase (gcl) from Escherichia coli O157:H7

KEGG orthology group: K01608, tartronate-semialdehyde synthase [EC: 4.1.1.47] (inferred from 98% identity to vap:Vapar_3954)

MetaCyc: 75% identical to glyoxylate carboligase (Escherichia coli K-12 substr. MG1655)
Tartronate-semialdehyde synthase. [EC: 4.1.1.47]

Predicted SEED Role

"Glyoxylate carboligase (EC 4.1.1.47)" in subsystem Allantoin Utilization or Photorespiration (oxidative C2 cycle) (EC 4.1.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (597 amino acids)

>ABID97_RS22320 glyoxylate carboligase (Variovorax sp. OAS795)
MAKMKAVQAAVLVMEKEGVTQAFGVPGAAINPMYSALRQRGSIGHILARHVEGASHMAEG
YTRAVAGNIGVCIGTSGPAGTDMITGLYSAWADSIPILCITGQAPRARLYKEDFQAVDIE
SISKPVTKWSVTVREPGQVPQVFQQAFHLMRSGRPGPVLIDLPFDVQMAEIEFDIDSYEP
LTPYKPAATRAQIEKAIGMLNAAERPLIVAGGGVINADASDLLVRFAEATGVPVIPTLMG
WGAIPDDHPLMAGMCGLQTSHRYGNATMLASDFVLGIGNRWANRHTGSIDVYTKGRTFVH
VDIEPTQIGRVFTPDFGIVSDAKAALEQFVAVAEEMKAAGKLPDRRPWARDCIERKKTML
RKTNFDSVPMKPQRVYQCMNNNFSNDTCYVSTIGLSQIAAAQFLHVYNPRHWINCGQAGP
LGWTIPAALGVRAADPSRKIVALSGDYDFQFMIEELAVGAQFKLPYIHIVVNNSYLGLIR
QAQRGFEMDYCVQLAFDNINAGPDAGIESSYGVDHLKVVEGLGCKAIRVNKQEEIAPAIQ
RAEALMAEFSVPVVIEVMLERVTNIAMGTEIDNITEFEPLAEHPADAPTAVAAEMLD