Protein Info for ABID97_RS22280 in Variovorax sp. OAS795

Annotation: C4-dicarboxylate transporter DctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 64 (19 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details amino acids 292 to 319 (28 residues), see Phobius details amino acids 324 to 341 (18 residues), see Phobius details amino acids 352 to 376 (25 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details PF00375: SDF" amino acids 8 to 403 (396 residues), 345.4 bits, see alignment E=2.3e-107

Best Hits

Swiss-Prot: 70% identical to DCTA2_RALSO: C4-dicarboxylate transport protein 2 (dctA2) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 96% identity to vap:Vapar_3948)

MetaCyc: 53% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"sodium:dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>ABID97_RS22280 C4-dicarboxylate transporter DctA (Variovorax sp. OAS795)
MPRFAKSLFGQVVIALVLGVLAGLFAPEFAVKLKPLGDGFIKLIKMIIPVLVFCVVVHGI
AGAGDLKRVGRVGVKALIYFEVLTTIALGMGLVLAFVFQPGAGMNVDPGKLDATAMSAYA
SNADKLTSGGTVEFLMKLIPTTVVNAFATGDVLQVLLFAVLFGCALSLLGDRGKPVGAVV
DSLSLVLFKIMGIIIKLAPLGVLGAIAFTVGKYGIGSLKQLGMLVALFYGAVLVFVFVVL
GLVMRMSGFSLWKLLRYLREELAIVFATTSSDSVLPQIMAKLRRMGIRDSTVGLVIPTGY
SFNLDAFSIYITLAAVFIAQATNTPISMADLLTILAIALVTSKGAHGVPGSAIVVLAATL
HAIPAIPAIGLVLVLSVDWFMGIARALGNLIGNCVATVAIAAWEGDIDRERAHAVLDGSY
SPDDEPLAEPELPVAPLGAGAASH