Protein Info for ABID97_RS22265 in Variovorax sp. OAS795

Annotation: nucleobase:cation symporter-2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 24 to 46 (23 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 142 to 167 (26 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 242 to 265 (24 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details amino acids 429 to 448 (20 residues), see Phobius details amino acids 455 to 478 (24 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 18 to 476 (459 residues), 379.1 bits, see alignment E=2.7e-117 PF00860: Xan_ur_permease" amino acids 23 to 172 (150 residues), 123.2 bits, see alignment E=5.5e-40 amino acids 211 to 443 (233 residues), 228.6 bits, see alignment E=5.3e-72

Best Hits

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 97% identity to vap:Vapar_3941)

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (498 amino acids)

>ABID97_RS22265 nucleobase:cation symporter-2 family protein (Variovorax sp. OAS795)
MTAETSSTVQTIHPVDQRLPSGKLAALGLQHVLVMYAGAVAVPLIVGRALKLSPDEVALL
ISADLFCCGIATLIQALGATQWFGIRLPVMMGVTFASVAPMVAIANANPGQNGAQLLFGA
IIGAGVVSILIAPLVSRMLRFFPPVVTGTIIAVIGISLMRVGINWIFGNPVGPTAPALVD
PVYAKWLAEVTSPGSSIPAVPKGFAIMPTVPNPKYADLSGFGVAALVLVSILLIVKYARG
FIANISVLLGIVIGAVVASITGLMTYEKVGKAAWVDVVLPFHFGMPQFDPILILTMTLIM
IVVMIESTGMFLALGEMTDRKITQKDLAKGLRTDGLGTLIGGIFNTFPYTSFSQNVGLVA
VTGIKSRYVCVAGGVILVVLGLLPKMAALIESLPTVVLGGAGLVMFGMVAATGIRILSGV
DFKGNRHNAMIVAVSIGIGMIPLIAPNFKQWMPHAIHSLVESGILLASISAVLLNLFLNG
AKQDDEAVIAAAKQAEAH