Protein Info for ABID97_RS22155 in Variovorax sp. OAS795

Annotation: acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13279: 4HBT_2
  • amino acids 13 to 136 (124 residues), 64.1 bits, E=1.7e-21
• PF03061: 4HBT
  • amino acids 22 to 105 (84 residues), 27.9 bits, E=2.4e-10

Best Hits

Swiss-Prot: 50% identical to 4HBT_PSEUC: 4-hydroxybenzoyl-CoA thioesterase from Pseudomonas sp. (strain CBS-3)

KEGG orthology group: K01075, 4-hydroxybenzoyl-CoA thioesterase [EC: 3.1.2.23] (inferred from 93% identity to vap:Vapar_3916)

MetaCyc: 50% identical to 4-hydroxybenzoyl-CoA thioesterase monomer (Pseudomonas sp. CBS3)
4-hydroxybenzoyl-CoA thioesterase. [EC: 3.1.2.23]

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase family active site" in subsystem Ton and Tol transport systems

MetaCyc Pathways

• 4-hydroxybenzoate biosynthesis III (plants) (5/5 steps found)
• 4-chlorobenzoate degradation (2/4 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.23

Use Curated BLAST to search for 3.1.2.23

Protein Sequence (143 amino acids)

>ABID97_RS22155 acyl-CoA thioesterase (Variovorax sp. OAS795)
MSSSKEITYTARVEFGDCDPAGIVWFPNFFRWIDAASRHFFAECGVPRWEETAQTLGVIG
TPLVDTHTRFVKAASYGDTLQIAVRITEWRDKSFVQTYRVARGDDLILECEEVRIFAARR
EGGGIRAVPIPPSIRALCEEVAS