Protein Info for ABID97_RS22030 in Variovorax sp. OAS795

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 PF00270: DEAD" amino acids 27 to 200 (174 residues), 166.5 bits, see alignment E=7e-53 PF04851: ResIII" amino acids 28 to 194 (167 residues), 35.3 bits, see alignment E=1.7e-12 PF00271: Helicase_C" amino acids 236 to 344 (109 residues), 104 bits, see alignment E=8.4e-34

Best Hits

KEGG orthology group: None (inferred from 97% identity to vpe:Varpa_4482)

Predicted SEED Role

"ATP-dependent RNA helicase Bcep18194_A5658" in subsystem ATP-dependent RNA helicases, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>ABID97_RS22030 DEAD/DEAH box helicase (Variovorax sp. OAS795)
MTSSFSNLSLAEPLARAVAEMGYETMTPIQEQAIPVVLSGQDVMGAAQTGTGKTAAFSLP
LLQRMLKHENTSTSPARHPVRALVLLPTRELADQVAQQVKLYAKYTNLRSTVVFGGIDMK
PQTLELKKGVEVLVATPGRLLDHIEAKNAVLNQVEYVVLDEADRMLDIGFLPDLQRILSY
LPKQRTTLLFSATFSPEIKRLAGSYLQNPVTIEVARPNETASTVEQHFYSVSDDDKRRAL
KQIVTQRGITQAFVFVNSKLGCARLARSLERDGLRTTALHGDKSQDERLKALASFKAGEV
DLLVCTDVAARGLDIKDVPAVFNFDIPFNAEDYVHRIGRTGRAGASGLAVSFASGGNDAR
LVADIEKLIKKKIELEPVEFEEDKPRGRINDGRRHWREEGEAGDARDVLDQPRERSSIGA
DARRGGGRPHRAPQASRDPFFDKPYEPGQADATPAWEAAAKAAPARGISSNIKSKRKVAA
LFKSAETL