Protein Info for ABID97_RS21905 in Variovorax sp. OAS795

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF13302: Acetyltransf_3" amino acids 8 to 143 (136 residues), 27.3 bits, see alignment E=1.3e-09 PF13527: Acetyltransf_9" amino acids 10 to 119 (110 residues), 31 bits, see alignment E=6.2e-11 PF13673: Acetyltransf_10" amino acids 32 to 141 (110 residues), 31.6 bits, see alignment E=3.6e-11 PF00583: Acetyltransf_1" amino acids 37 to 142 (106 residues), 59.2 bits, see alignment E=1.2e-19 PF13508: Acetyltransf_7" amino acids 60 to 142 (83 residues), 41.2 bits, see alignment E=4.6e-14

Best Hits

KEGG orthology group: None (inferred from 86% identity to vap:Vapar_3851)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>ABID97_RS21905 GNAT family N-acetyltransferase (Variovorax sp. OAS795)
MTTSPASLVIRPPTRDDFARWKPLWDGYNAFYKREGPTALPHEITQATWQRFFDAYEPVH
ALVAERNGQLVGLTHYLFHRSTTRIEPVCYLQDLFTLPTERGRGVGRQLIEGVCAHVKGV
GAHRLYWQTHTTNAAGRKLYNKVATHDGFIVYGTYV