Protein Info for ABID97_RS21865 in Variovorax sp. OAS795

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 31 to 189 (159 residues), 96 bits, see alignment E=9.7e-32 PF04542: Sigma70_r2" amino acids 35 to 100 (66 residues), 67.9 bits, see alignment E=8.2e-23 PF08281: Sigma70_r4_2" amino acids 136 to 186 (51 residues), 53.9 bits, see alignment E=1.7e-18 PF04545: Sigma70_r4" amino acids 139 to 188 (50 residues), 53.4 bits, see alignment E=2.2e-18

Best Hits

Swiss-Prot: 44% identical to RPOE_RHOS4: ECF RNA polymerase sigma factor RpoE (rpoE) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 49% identity to mlo:mlr8088)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>ABID97_RS21865 sigma-70 family RNA polymerase sigma factor (Variovorax sp. OAS795)
MTLHQGRDAMPTSEELNSLAEAVARNADRQAFAALFKHFAPRVKSYLMRLGTSEGLAEEL
AQEAMVSVWRKAQSFDAGRANVSTWIFTIARNLRVDHFRRIGNRTAEVDELDGDETPDTL
PQPDEVLLTRQREAGVREAIAQLPAEQAQVLRLSFYEEQPHSQIAEALGLPLGTVKSRVR
LAVRHLRRLLDGLEP