Protein Info for ABID97_RS21850 in Variovorax sp. OAS795

Annotation: cyclopropane-fatty-acyl-phospholipid synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF02353: CMAS" amino acids 146 to 411 (266 residues), 269 bits, see alignment E=1.9e-83 PF13489: Methyltransf_23" amino acids 189 to 352 (164 residues), 56.6 bits, see alignment E=1e-18 PF05175: MTS" amino acids 199 to 274 (76 residues), 26.2 bits, see alignment E=2.3e-09 PF13847: Methyltransf_31" amino acids 205 to 312 (108 residues), 33.6 bits, see alignment E=1.3e-11 PF13649: Methyltransf_25" amino acids 207 to 301 (95 residues), 59.6 bits, see alignment E=1.6e-19 PF08241: Methyltransf_11" amino acids 208 to 304 (97 residues), 42.6 bits, see alignment E=3.2e-14 PF08242: Methyltransf_12" amino acids 208 to 302 (95 residues), 47.1 bits, see alignment E=1.3e-15

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 63% identity to aaa:Acav_3484)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79), plant type" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>ABID97_RS21850 cyclopropane-fatty-acyl-phospholipid synthase family protein (Variovorax sp. OAS795)
MSTSPSSPSNGLEADALCPSTAFAPAAWTRRPLRRLLVRLLRGVRCGTIAVELPNGERVE
GRGATEGPHAAISLHRWRPLARMLLRGDIGLAESYRDGDWSSPDLPALLEFGIRNESGWG
RVFEASLPARLFGRAVHRLRANTRRGSRQNISFHYDMGNAFYARWLDPEMIYSSALYATG
DESLEEAQAAKIARVAELLAPAPEAKVLEIGCGWGALALALARRHGAHVTGLTLSTEQLG
HARRRVEEEGMSARVDLRLQDYRDVEGRYDRIVSIEMLEAVGERYWPVYFDTLRERLAPG
GIAVVQVITIADAHFDHYRRSPDFIQRFIFPGGMLPSVGALEAQAARAGLTLERAESFGA
SYAATLAEWRHRFLAAWPAIEPLGFDAAFKRLWEYYLSYCEAGFLSERVDVGLFTLRHAP
AAA