Protein Info for ABID97_RS21775 in Variovorax sp. OAS795

Annotation: class 1 fructose-bisphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00316: FBPase
  • amino acids 8 to 197 (190 residues), 203 bits, E=3.5e-64
• PF18913: FBPase_C
  • amino acids 201 to 334 (134 residues), 166.8 bits, E=2e-53

Best Hits

Swiss-Prot: 88% identical to F16A1_POLNA: Fructose-1,6-bisphosphatase class 1 1 (fbp1) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 98% identity to vpe:Varpa_4381)

MetaCyc: 45% identical to fructose-1,6-bisphosphatase (Arabidopsis thaliana col)
Fructose-bisphosphatase. [EC: 3.1.3.11]

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (24/26 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• glycolysis II (from fructose 6-phosphate) (11/11 steps found)
• glycolysis I (from glucose 6-phosphate) (12/13 steps found)
• gluconeogenesis III (11/12 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (21/26 steps found)
• Calvin-Benson-Bassham cycle (11/13 steps found)
• gluconeogenesis I (11/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• superpathway of hexitol degradation (bacteria) (13/18 steps found)
• oxygenic photosynthesis (12/17 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.11

Use Curated BLAST to search for 3.1.3.11

Protein Sequence (338 amino acids)

>ABID97_RS21775 class 1 fructose-bisphosphatase (Variovorax sp. OAS795)
MAQQQKISLTRYLVEQQRADGLIPGQLRLLLEVVARACKSISQAVNKGALGGVLGTAESE
NVQGEIQKKLDIIANEVLIEANEWGGHLAAMASEEMDSIYVVPNRYPQGEYLLMFDPLDG
SSNIDVNVSIGTIFSVLKKPDDTPGVQEADFLQPGTQQVAAGYCIYGPQTTLVLTVGNGV
AMFTLDREQGSFVLTQEDIQIPADTKEFAINMSNMRHWDEPMKRYIEECLAGKEGPRGKD
FNMRWIASMVADVHRILMRGGVFMYPWDKREPEKAGKLRLMYEANPMSWLVEQAGGAATN
GKQRILDLKPTKLHERVSVMLGSRNEVERLTRYHAEKA