Protein Info for ABID97_RS21570 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 196 to 221 (26 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 276 to 303 (28 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 218 to 407 (190 residues), 42.6 bits, see alignment E=2.9e-15

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 97% identity to vap:Vapar_4698)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>ABID97_RS21570 ABC transporter permease (Variovorax sp. OAS795)
MSVPLASAEAPPGELRRALARAESRRKWRAFALTLPLLVFLLLTLLVPIVALLQRAVENP
EVANALPRTVRALDGWDRKEAPAPAAYAAFAADLGQLPDSSDAGALARRLNTEIAGARSL
VMGAFRALPIAGTPDEIKARMLALDPRWGEAPFWQAIAKNGSRWTPDYLLASVDLRRDVA
GEVERMPADQRAFAGILLRTFNISAVVTFFCLLLAYPLAWWLSTLPARKANVLMILVLVP
FWTSILVRVAAWIVLLQSEGLVNRGLMGIGLIDHPLALLFNRTGVIIAMVHILLPFMILP
LYSVMKSVPPTYLRAAVSLGSSPLAAFFRVYVPQTYPGIGAGALLVFILAIGYYVTPALL
GGADDQMLSYYIARYTNVEINWGMACALGAVLLVATLLLYAVYRRIGKAELSLG