Protein Info for ABID97_RS21460 in Variovorax sp. OAS795

Annotation: lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 49% identical to PVDA_PSEAE: L-ornithine N(5)-monooxygenase (pvdA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10531, L-ornithine N5-oxygenase [EC: 1.13.12.-] (inferred from 82% identity to vap:Vapar_3740)

MetaCyc: 49% identical to L-ornithine 5-monooxygenase (Pseudomonas aeruginosa PAO1)
RXN-11128 [EC: 1.14.13.195]

Predicted SEED Role

"L-ornithine 5-monooxygenase (EC 1.13.12.-), PvdA of pyoverdin biosynthesis" in subsystem Siderophore Pyoverdine (EC 1.13.12.-)

MetaCyc Pathways

ferrichrome A biosynthesis (3/5 steps found)
pyoverdine I biosynthesis (3/11 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.12.- or 1.14.13.195

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>ABID97_RS21460 lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein (Variovorax sp. OAS795)
MVIHDLIGIGFGPSNIALAIALDEKRREGRCVDAVFIEKQAGFAWHKDMMLDQAHMQISF
MKDLATLRNPTSRFTFINYLHESKRLQDFINLKTFFPSRHEFNDYLGWAAAQFEDACVYG
EQVFEVLPEKETQGGEVSLLRVRSRNGAGAVTERLARNLVVGIGGMPNIPEGFGPLRDDP
RVFHSSGYLRGMARLPDAARIAIVGAGQSAAEIFMDLQGRPHAPQVDLIMRARSIRPSDD
SPFVNEVFNVEFTDYIYGQPEDERAALIDEFGHTNYAVADLDLIQQIFKMFYEQKVRGED
RMRFLRRHEIRGVQAAADGIHLTLFDQDSGADGTSRYDAVVLATGYAREQHKALLAPLAP
YLGDFSVDRHYRVGSTPDFHPAIFLQGACEASHGLSDTLLSVTSVRTGEIGSALLKAIPG
GAPVAAAADAANSALREREAVRA