Protein Info for ABID97_RS21440 in Variovorax sp. OAS795

Annotation: cyclic peptide export ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 241 to 265 (25 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details TIGR01194: cyclic peptide transporter" amino acids 11 to 553 (543 residues), 622.4 bits, see alignment E=3.6e-191 PF00664: ABC_membrane" amino acids 24 to 171 (148 residues), 30 bits, see alignment E=6.6e-11 PF00005: ABC_tran" amino acids 358 to 498 (141 residues), 83.5 bits, see alignment E=3.6e-27

Best Hits

KEGG orthology group: K06160, putative ATP-binding cassette transporter (inferred from 84% identity to vap:Vapar_3736)

Predicted SEED Role

"PvdE, pyoverdine ABC export system, fused ATPase and permease components" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (564 amino acids)

>ABID97_RS21440 cyclic peptide export ABC transporter (Variovorax sp. OAS795)
MTTTTTPGNGAEIARLLKPFLPWIVLSAVTGVGAGAATVALLGTINRVLNQPGGLAGGLL
LTFIGLCGVALFGRMVSDVSTNFVGQRLVAQVRKSLAQKILSAPIDALERYRTHRLMPVL
SQDVDMISDVAFALSGTLIALAVALGCLGYLAFLSLPLFGLMLVALAIGITVQLMAQIRG
EAGFWKAREQEDQLHKAYRAISEGAKELRMHRARRTRMFAGQIERIVDTIRVVNGRAINT
YVIATAFGSALFFLLIALILGWAAFRTTEPAVVSGFVLVLLFLKGPLDQIALTLPGVGRA
KVAFERIGDLSARFATPEPHLHLARASNGVILKNEIGMRSVRYAFDAPEGGEAFTLGPID
LQLRRGEMVFVVGDNGSGKTTLVKLLLGLYAPQAGEVLIDGSVVKPEGRDDYRQLFTTVF
SDFYLFEDLVAGEESEGGAGMEVLPETALPYLERLEIAHKVSLKNGAFSTTDLSTGQRKR
LALVHAYLEGRPVLVFDEWAADQDPAFRHLFYTELLPELRAKGHLLVVISHDDRYFHLAD
RVITMRAGKIAEDRVHASRESLAA