Protein Info for ABID97_RS21115 in Variovorax sp. OAS795

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 53 to 79 (27 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 11 to 107 (97 residues), 90.2 bits, see alignment E=5.1e-30 PF00528: BPD_transp_1" amino acids 34 to 211 (178 residues), 58 bits, see alignment E=5.6e-20

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 97% identity to vap:Vapar_3669)

Predicted SEED Role

"Putative amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>ABID97_RS21115 amino acid ABC transporter permease (Variovorax sp. OAS795)
MVDFSLWDILRNLLMALRWTVVLSLIAFVGGGLVGGLLLFLRLRGGSAMNRAVGFYVQLF
QGTPLLMQLFLAYFGIALFGVDVSAWTAASVALTLYTSAFLTEIWRGCVASIPKGQWEAS
GSLALGFSEQMRHVILPQAVKIAIAPTVGFLVQVIKGTALASVIGFVELTKAGSMISNAT
FQPFVVFSCVALLYFVLCFPVSLYAKNLERKSHGRRA