Protein Info for ABID97_RS21110 in Variovorax sp. OAS795

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 109 (97 residues), 103.4 bits, see alignment E=3.8e-34 PF00528: BPD_transp_1" amino acids 33 to 214 (182 residues), 66 bits, see alignment E=1.9e-22

Best Hits

Swiss-Prot: 38% identical to TCYB_BACSU: L-cystine transport system permease protein TcyB (tcyB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 95% identity to vap:Vapar_3668)

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>ABID97_RS21110 amino acid ABC transporter permease (Variovorax sp. OAS795)
MEFDFGAVLVDWRLLAKGVAWTIGLTAIATVIGMAVGVACAWARANGPPWLRWVAGSYVE
LIRNTPFIVQLFFIFFGLPAAGVKLMPETASIIAMVMNLGAYATEIIRAGIEATPKGQIE
AAVSLALDKVQVFTRVVLPPALKKVWPAMVSQIIIVMLGSAVCGQISTEELSYAANLIQS
RNFRAFESFIIATLIYLALAVALRRLLNWAGPRFFFGR