Protein Info for ABID97_RS21070 in Variovorax sp. OAS795

Annotation: ergothioneine biosynthesis protein EgtB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details TIGR03440: ergothioneine biosynthesis protein EgtB" amino acids 15 to 415 (401 residues), 503.3 bits, see alignment E=3.5e-155 PF12867: DinB_2" amino acids 18 to 153 (136 residues), 38.9 bits, see alignment E=1.1e-13 PF03781: FGE-sulfatase" amino acids 191 to 333 (143 residues), 70.1 bits, see alignment E=2.5e-23 amino acids 338 to 416 (79 residues), 27.2 bits, see alignment E=3e-10

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_3660)

Predicted SEED Role

"FIG00453801: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>ABID97_RS21070 ergothioneine biosynthesis protein EgtB (Variovorax sp. OAS795)
MTLSRPNAQAASALRDKFREVRAASLALAAPLSAEDQCIQSMPDASPTKWHLAHTTWFFE
TVLLQPHAAGYRPFDTRFHYLFNSYYEALGPRHPRPHRGLLTRPSVDEVHAYRSHVDEAV
LALLDGDAGEQGWTAIEPIVTLGLHHEQQHQELLLTDILHALSCNPLLPAYKPAAGPALR
LAAVPAAMRWLPQPGGVVQVGHEGPQQVFAFDNETPRHSALLQPYAIADRLVNCGDFAQF
IADGGYQRPELWLSDGWAAVQAQGWRHPAYWLAADDPRLGAQQQQGGWHVFGLHGVRPME
ADAPVSQLSFYEAAAYAEWAGARLPTEFEWEAAFDVPGISQMNSHVWQWTRSSYDPYPGF
RPMPGIAAEYNGKFMVGQLVLRGGSVATPPGHTRPSYRNFFPPAARWQFSGLRLAKDL