Protein Info for ABID97_RS20985 in Variovorax sp. OAS795

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF13417: GST_N_3" amino acids 11 to 81 (71 residues), 58.1 bits, see alignment E=2.2e-19 PF02798: GST_N" amino acids 11 to 76 (66 residues), 25.8 bits, see alignment E=2.7e-09 PF13409: GST_N_2" amino acids 17 to 77 (61 residues), 58.4 bits, see alignment E=2.2e-19 PF13410: GST_C_2" amino acids 129 to 189 (61 residues), 37.3 bits, see alignment E=5.8e-13 PF00043: GST_C" amino acids 137 to 191 (55 residues), 24.3 bits, see alignment E=7.5e-09

Best Hits

KEGG orthology group: None (inferred from 79% identity to vap:Vapar_3641)

Predicted SEED Role

"Glutathione S-transferase domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>ABID97_RS20985 glutathione S-transferase (Variovorax sp. OAS795)
MQLQPPGLPVLYSFRRCPYAMRARLAMAASGERCELREVVLKNKPAEMLAASPKGTVPVL
VLPDGAVLEQSLDIMRWTLHRNDPLRWLEPDAGTLAAMLALVAECDGNFKLQLDRYKYPG
RFAGLSTDARGRGAQFLLHLDARLADTGQLFGARASLADAAIVPFVRQFAMVEPAWFEGE
PWPNLRAWLSGWTGSPLFERAMRKYAPWNAGESGVAYPPA