Protein Info for ABID97_RS20745 in Variovorax sp. OAS795

Annotation: mechanosensitive ion channel domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 181 to 247 (67 residues), 46.3 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: None (inferred from 87% identity to vap:Vapar_3568)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>ABID97_RS20745 mechanosensitive ion channel domain-containing protein (Variovorax sp. OAS795)
MTEEILAHPWFGTWLAAFVGIPLALLIHRVGGLVLMRVTRPTPALHAMVANCKAVARLVL
PLVALLLVFQAAPDNLRFIGSVRHFNGLLLIGATTWLLVKAINGFADGVLAQHPHDVEDN
LHARRVLTQTRVLARTAMTMVLVAGGAMMLMTFPGARQVGASLLASAGVIGIVAGLAAKP
VFSNLIAGLQIALAQPIRMDDVLVVEGEWGRVEEITGTFVVVKIWDDRRLILPLSYFIEK
PFQNWTRQSSQLLGAVFVYVDYGMPVAPLRAEVERIVKAAPEWDRRFFNLQVTDATERSM
QIRVLCTAGNSSLAFDLRCKVREGLIDFMQRDYPQFLPKMRIEGDALQAARLDLPAAQDS
APPR