Protein Info for ABID97_RS20730 in Variovorax sp. OAS795

Annotation: RNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR00050: RNA methyltransferase, TrmH family, group 1" amino acids 2 to 234 (233 residues), 176 bits, see alignment E=5.5e-56 PF00588: SpoU_methylase" amino acids 4 to 154 (151 residues), 81.8 bits, see alignment E=2.7e-27

Best Hits

KEGG orthology group: K02533, tRNA/rRNA methyltransferase [EC: 2.1.1.-] (inferred from 93% identity to vpe:Varpa_4101)

Predicted SEED Role

"tRNA:Cm32/Um32 methyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>ABID97_RS20730 RNA methyltransferase (Variovorax sp. OAS795)
MRTRFILIQTSHAGNVGAAARAMKTMGFDDLVLVAPRWANVLRREETIQRASGALDVLNN
ARIVETLDEALDGITHLCATAMVPRDFGPPTRTPREHLEPLARQDGQHVAFLFGSERFGM
RNEDVYRCNVALSIPTDPNFGSLNLGAAIQVVAYEWRLALGGYAVRDATAPVQAADAKAV
AGMLDHWERALVEIGFLDPKAPKKLMPRLQQLFNRAQPTPEEIHILRGIAKAMSDAAKTP
TNVREDPAP