Protein Info for ABID97_RS20710 in Variovorax sp. OAS795

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 168 to 193 (26 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 238 to 268 (31 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 316 to 339 (24 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 15 to 399 (385 residues), 173.7 bits, see alignment E=2.8e-55

Best Hits

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_3561)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>ABID97_RS20710 cation:proton antiporter (Variovorax sp. OAS795)
MSATSLLLQLIVILSTARVCGWVLRHVGQPGVVGEMAAGLMLGPVVMGALFPSLHAQLFS
RSHLEGLSSLSTVGLVLFMFVVGLELRSTQGVRAQLKAAGYVGALSVIVPMALGIAISPA
LHPALAPAGVGFWPFALFMAAALSITAFPVMARILKDRGLTRTPFGQLSLGAAAVVDVFA
WILLALVVAMVGAGEGYVGFLKTTAGVAVLLAVLFFGLKPAFAWLLRTRAPDGEPSTTVM
ASLMIGLLACAMATEWLHLHAVFGAFLFGACLPRDDRLLSSLTQRIEPISIVVLMPLFFA
LAGLGTTSSAFSGASIGAMLLIVAVAAIGKLAGGAIGARMAGYGWRDSLATGSLMNARGL
MELIVMKIGLDAGLIGPELFTMLLVMALVTTAMTGPLINLVMGRAKASPAAQPESEVQVR
AKP