Protein Info for ABID97_RS20580 in Variovorax sp. OAS795

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 213 to 237 (25 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details amino acids 334 to 351 (18 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 351 (333 residues), 139.2 bits, see alignment E=8.4e-45

Best Hits

Swiss-Prot: 40% identical to NASA_BACSU: Nitrate transporter (nasA) from Bacillus subtilis (strain 168)

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 96% identity to vap:Vapar_3526)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>ABID97_RS20580 MFS transporter (Variovorax sp. OAS795)
MSSFRTFLQSGHGPTLFSAFLYFSFSCCIWVLNGAMAPFIGETFDLSPAQKGLMLSVPII
AGALMRFPLGILSQYIGRKNATLVEMALIAVAMLFGFFFVKSFNDLLAMGVLLGIAGASF
GVALSLGSGWFPPQHKGLAMGLVGAGNVGTAVSVLVAPPLAQWLGWQAVYGVAAAAILVP
MAVMIVFAKEPPDVDSHASFREHIACLFEKDGWVFSLIYGVTFGGFIGLITFLPSYYYDQ
FGVSKVQAGQLTMLAAFMGAAVRIVGGWISDRWGGVNTLTVVLLAVAVGLVLVGISSSSL
ALTTLLLILCFAALGAGNGALFQLVPLRWPTSTAVAGSMIGEIGALGGGLVPNAMGLSKQ
YLGSYVWGFVFFGALSLVMLGVMRVMQIRWTRTWAEKGGRARSSPQPAAAKKYVAPRKAA
RP