Protein Info for ABID97_RS20550 in Variovorax sp. OAS795

Annotation: tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 4 to 311 (308 residues), 357.6 bits, see alignment E=5.6e-111 TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 4 to 318 (315 residues), 426.4 bits, see alignment E=6.4e-132 PF00814: TsaD" amino acids 30 to 311 (282 residues), 314 bits, see alignment E=1e-97 PF22521: HypF_C_2" amino acids 234 to 307 (74 residues), 31.1 bits, see alignment E=2e-11

Best Hits

Swiss-Prot: 96% identical to TSAD_VARPS: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 96% identity to vap:Vapar_3520)

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>ABID97_RS20550 tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD (Variovorax sp. OAS795)
MLLLGIESSCDETGVALVESRGSALPLLRAHALHSQIAMHQAYGGVVPELASRDHIRRVL
PLTEAVMAEAGRSLAEIDVVAYTRGPGLAGALLVGAGVACALGAALGKPVLGVHHLEGHL
LSPFLSADPPEFPFVALLVSGGHTQLMRVDGVGRYALLGETIDDAAGEAFDKSAKLMGLP
YPGGPWLAKLAEEGNATAFKLPRPLLHSGDLDFSFAGLKTAVLTQAKKLGAGLEANKADL
AASTQAAIVEVLLKKSMAALEQTGLQRLVVAGGVGANRSLREQLNAACARRGVRVHYPEL
HLCTDNGAMIAMAAAMRLQSGLAEASERYAFDVKPRWPMASLMASGTALQASA