Protein Info for ABID97_RS20490 in Variovorax sp. OAS795

Annotation: NADH-quinone oxidoreductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 11 to 152 (142 residues), 252.6 bits, E=5.2e-80
• PF01058: Oxidored_q6
  • amino acids 37 to 145 (109 residues), 95.8 bits, E=8.8e-32

Best Hits

Swiss-Prot: 100% identical to NUOB_VARPS: NADH-quinone oxidoreductase subunit B (nuoB) from Variovorax paradoxus (strain S110)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 99% identity to vpe:Varpa_4024)

MetaCyc: 59% identical to ferredoxin-menaquinone dehydrogenase subunit B (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (159 amino acids)

>ABID97_RS20490 NADH-quinone oxidoreductase subunit B (Variovorax sp. OAS795)
MAIEGVMKEGFVTTTYDSVVNWAKTGSLWPMTFGLACCAVEMMHAGAARYDIDRFGMLFR
PSPRQSDLMIVAGTLCNKMAPALRKVYDQMPEPRWVLSMGSCANGGGYYHYSYSVVRGCD
RIVPVDVYVPGCPPTAEALLYGVIQLQQKIRRTNTIARA