Protein Info for ABID97_RS20455 in Variovorax sp. OAS795

Annotation: NADH-quinone oxidoreductase subunit NuoI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 22 to 35 (14 residues), see Phobius details TIGR01971: NADH-quinone oxidoreductase, chain I" amino acids 30 to 151 (122 residues), 153.1 bits, see alignment E=1.2e-49 PF00037: Fer4" amino acids 71 to 90 (20 residues), 24.1 bits, see alignment (E = 1.1e-08) amino acids 107 to 128 (22 residues), 30.1 bits, see alignment (E = 1.4e-10) PF13237: Fer4_10" amino acids 71 to 124 (54 residues), 29.1 bits, see alignment E=3.5e-10 PF12800: Fer4_4" amino acids 72 to 86 (15 residues), 17.7 bits, see alignment (E = 1.6e-06) amino acids 111 to 125 (15 residues), 12.9 bits, see alignment (E = 5.6e-05) PF13187: Fer4_9" amino acids 73 to 126 (54 residues), 34.5 bits, see alignment E=7.9e-12 PF12838: Fer4_7" amino acids 73 to 126 (54 residues), 43.3 bits, see alignment E=1.8e-14

Best Hits

Swiss-Prot: 88% identical to NUOI_VEREI: NADH-quinone oxidoreductase subunit I (nuoI) from Verminephrobacter eiseniae (strain EF01-2)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 93% identity to vpe:Varpa_4017)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>ABID97_RS20455 NADH-quinone oxidoreductase subunit NuoI (Variovorax sp. OAS795)
MSAAHTATTSAPFSLKDFLGSFMLFELFKGLAITGKYAFARKITVQFPEEKTPLSPRFRG
LHALRRYENGEERCIACKLCEAVCPALAITIESDVRDDGSRRTTRYDIDLTKCIFCGFCE
ESCPVDSIVETHIFEYHGEKRGDLYFTKDMLLAVGDRYEKEIAANKAADAKYR