Protein Info for ABID97_RS20445 in Variovorax sp. OAS795
Annotation: NADH-quinone oxidoreductase subunit NuoK
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to NUOK_VARPS: NADH-quinone oxidoreductase subunit K (nuoK) from Variovorax paradoxus (strain S110)
KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 98% identity to vpe:Varpa_4015)MetaCyc: 48% identical to ferredoxin-plastoquinone oxidoreductase subunit E (Synechococcus elongatus PCC 7942 = FACHB-805)
Predicted SEED Role
"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)
MetaCyc Pathways
- aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
- NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
- aerobic respiration I (cytochrome c) (3/4 steps found)
- NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
- NAD(P)/NADPH interconversion (3/6 steps found)
- Fe(II) oxidation (2/6 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.6.5.3
Use Curated BLAST to search for 1.6.5.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (102 amino acids)
>ABID97_RS20445 NADH-quinone oxidoreductase subunit NuoK (Variovorax sp. OAS795) MTLTLGHFLSLGAMLFALSVIGIFLNRKNLIVLLMAIELMLLAVNMNFVAFSYYLNDMHG QIFVFFILTVAAAESAIGLALLVLLFRNKSNINVDELNSLKG