Protein Info for ABID97_RS20325 in Variovorax sp. OAS795

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00005: ABC_tran" amino acids 19 to 164 (146 residues), 125.2 bits, see alignment E=3e-40

Best Hits

Swiss-Prot: 48% identical to LOLD_DECAR: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K02003, (no description) (inferred from 94% identity to vap:Vapar_3469)

MetaCyc: 42% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>ABID97_RS20325 ABC transporter ATP-binding protein (Variovorax sp. OAS795)
MTLHISQLAKHYGDVPVFENVTLTVEPGEFVAIVGESGVGKSTLLNCMAGLDSWDAGTVS
HDGTDIGALDGEACALWRRRHVGFVFQAFHVLPHLDVAQNVSLPLMLLGRQRDDSRVAHM
LEAVGLPGMGARLPQTLSGGQLQRVAIARALVHRPALLLADEPTGNLDPGTAAKVMELLI
GQTREHGASLVLVTHSESAAARADRLLHLTAEGIRA