Protein Info for ABID97_RS20055 in Variovorax sp. OAS795

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 111 (98 residues), 101.2 bits, see alignment E=2e-33 PF00528: BPD_transp_1" amino acids 35 to 216 (182 residues), 84.1 bits, see alignment E=5.3e-28

Best Hits

Swiss-Prot: 35% identical to GLNP_ECOL6: Glutamine transport system permease protein GlnP (glnP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 98% identity to vpe:Varpa_2195)

MetaCyc: 35% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"polar amino acid ABC transporter, inner membrane subunit"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>ABID97_RS20055 amino acid ABC transporter permease (Variovorax sp. OAS795)
MNYQFQFDAVFAAWPLLLKGTWITVQLSLSATLIGLVVAIFCAWGKTSGPGWLRFIVNAY
IEVIRNTPFLVQLFFFFFALPAIGLRWSPQTAALVAMVVNLGAYATEIIRAGIESIPKGQ
IEAGRALNLKPWEIFRFVIIKPALKAIYPALTSQFILLMLSSAVVSVISADDLTSVAANL
QSQTFRSFEIYIVVAAIYLALALAFSALFKLIYKRTLNYPDRR