Protein Info for ABID97_RS19985 in Variovorax sp. OAS795

Annotation: circularly permuted type 2 ATP-grasp protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 PF14403: CP_ATPgrasp_2" amino acids 78 to 457 (380 residues), 553.5 bits, see alignment E=2.2e-170 PF04174: CP_ATPgrasp_1" amino acids 78 to 413 (336 residues), 512.3 bits, see alignment E=5.3e-158

Best Hits

Swiss-Prot: 54% identical to Y335_SYNY3: Uncharacterized protein sll0335 (sll0335) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 97% identity to vap:Vapar_3403)

Predicted SEED Role

"Protein containing domains DUF404, DUF407"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>ABID97_RS19985 circularly permuted type 2 ATP-grasp protein (Variovorax sp. OAS795)
MHKFDEMYEQLPYAGAAIRQHYKRYDQWLAKQPGEVMRARREEAEMIFRRVGITFAVYGA
KDEDGSGTERLIPFDLLPRIIPAHEWESMEKGLVQRVTALNRFLHDVYHDQEIIKAGIIP
AEQILNNAQFRPEMMGVSVPHNVYSNISGIDIVRAPDAQGNGEYYVLEDNLRVPSGVSYM
LENRKMMMRLFPELFNQNRIAPVAHYPDLLLETLRASAPAATAEPTVVVLTPGMYNSAYF
EHAFLAQQMGVELVEGQDLFVKDNFVYMRTTRGPKRVDVIYRRVDDDFLDPEVFRPTSTL
GCAGLMRAYRDGNVVICNAVGTGVADDKSIYPYVPKMVEFYLGEQPILKNVPTYMCRNKD
ELQYTLDNMKDLVVKEVHGAGGYGMLIGPAATLAEIEEFKKAVIAKPDGYIAQPTLSLST
SPTFVDAGIAPRHIDLRPFVLSGKEVQMVPGGLTRVALKEGSLVVNSSQGGGTKDTWILE
ADRSPKPKAAGGTQSQSQSA