Protein Info for ABID97_RS19950 in Variovorax sp. OAS795

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 26 to 158 (133 residues), 96.1 bits, E=4.6e-31
• PF08402: TOBE_2
  • amino acids 270 to 341 (72 residues), 32.3 bits, E=1.3e-11
• PF03459: TOBE
  • amino acids 287 to 337 (51 residues), 22.8 bits, 1.3e-08

Best Hits

Swiss-Prot: 35% identical to AGLK_RHIME: Alpha-glucoside transport ATP-binding protein AglK (aglK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 96% identity to vap:Vapar_3396)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Protein Sequence (357 amino acids)

>ABID97_RS19950 ABC transporter ATP-binding protein (Variovorax sp. OAS795)
MQLTLERVTKKVGAQTWLYEQSIAPRSGAVTVLLGATQAGKTSLMRLMAGLDTPSTGQVL
VDGKDVTGMPVRERNVAMVYQQFINYPSLKVADNIASPLKLRGEKNIEARVKALADKLHI
GMFLDRLPAELSGGQQQRVALARALAKNAPLMLLDEPLVNLDYKLREGLREELTQLFATG
DSTVIYATTEPGEALLLGGYTAVMDAGELLQYGPTADVFHAPQSLRVARAFSDPPMNLLP
GTATAGRVQLAGGPALALAVPESVSGAVTVGLRASALNVDAGAGDMALPGKVELAEISGS
DTFVHVDTAVGELVAQLTGVHRFELGTPITLYFSASQAYVFDAGEKLALAPAWRKGN