Protein Info for ABID97_RS19935 in Variovorax sp. OAS795

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 180 to 205 (26 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 259 (175 residues), 40.6 bits, see alignment E=1.2e-14

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 98% identity to vap:Vapar_3393)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>ABID97_RS19935 carbohydrate ABC transporter permease (Variovorax sp. OAS795)
MPEKRFRKRSIFLVLYILFALLPIYWMVNMSFKTNEEIVSSFSFFPHELTWANYARIFTD
ESWYSGYINSLIYVAINTVISLTVALPAAYAFSRYSFLGDKHVFFWLLTNRMTPPAVFLL
PFFQLYSTVGLMDTHLGVALAHLLFNVPLAVWILEGFMSGIPREIDETAYIDGYSFPKFF
IRIFLPLIKAGVGVAAFFCFMFSWVELLLARTLTSVNAKPIVATMTRTVSASGMDWATLA
AAGVLTIVPGAIVIWFVRHYIAKGFAMGRV