Protein Info for ABID97_RS19930 in Variovorax sp. OAS795

Annotation: DUF2160 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 82 to 99 (18 residues), see Phobius details PF09928: DUF2160" amino acids 4 to 102 (99 residues), 126.8 bits, see alignment E=1.7e-41

Best Hits

KEGG orthology group: None (inferred from 92% identity to vap:Vapar_3392)

Predicted SEED Role

"FIG00761799: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>ABID97_RS19930 DUF2160 domain-containing protein (Variovorax sp. OAS795)
MFDWMVWTTPVAVFFSCIALMLVGMTVWEFKSPTTMRRGWLPIATTRGDRLFIGLLSAAY
LNLVFIGLAGKFQEWLGLQAEPSIWVSFVLSMLLLALVMRKG