Protein Info for ABID97_RS19910 in Variovorax sp. OAS795

Annotation: DUF3488 and transglutaminase-like domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 transmembrane" amino acids 14 to 30 (17 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 562 to 583 (22 residues), see Phobius details PF11992: TgpA_N" amino acids 21 to 339 (319 residues), 233.7 bits, see alignment E=3e-73 PF01841: Transglut_core" amino acids 384 to 485 (102 residues), 79.1 bits, see alignment E=2.9e-26

Best Hits

KEGG orthology group: None (inferred from 89% identity to vap:Vapar_3379)

Predicted SEED Role

"FIG001454: Transglutaminase-like enzymes, putative cysteine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (672 amino acids)

>ABID97_RS19910 DUF3488 and transglutaminase-like domain-containing protein (Variovorax sp. OAS795)
MNKFLREISSLPRDARDTLFLLIVIALIVLPQAENLPWWCTAITAMVLVYRGMLAIDARP
LPGRWARVGLLLLTLTATFATHRTLLGRDAGVTLVVILLALKTLELRARRDAFVLFFLGF
FAMLTNFFYSQSLMTAVTMLLALLGLLTALVNAHMPVGKPPLMLAARTAAWMALLGAPIM
LALFLLFPRFAPLWGTPTDAMAGRTGLSNTMRVGTIAQLALDDGIAARIKFENDRAPPQS
QLYFRGPVLAQFDGREWTALPSWARGGTAPDNLRTSGEPVRYEVTLEPSQRPWLLTLDAA
QTPPDVPGFGVVGTPDLQWLASRPISDLVRYRAESYTQFQSGPLRQTAALRPYLALPPGS
NPRTAALAAEMRAQPDLANADTQAFVRAALQRLRTGGYTYTLEPGFYGNETADEFWFDRK
EGFCEHIASAFVVLMRGLGIPARIVTGYQGGELNGVDNFWVLRQSDAHAWAEVWQQGVGW
MRVDPTGAVSPGRVGQFQRLVPPPGLFAGAIGAVSPTLAQNVRAAWEAVNNGWNQWVLNY
TQSRQLNLLKNLGFDAPSLEDLAYVLLYLLVGASLAGAGWALWERSQHDPWLRLLAQART
RLAKAGLQLPETAPPRQMAAQAEARFGPSAQAVRDWLLKLEAQRYAPASPTSLAALRAEF
RRLDWPVARSVH