Protein Info for ABID97_RS19900 in Variovorax sp. OAS795

Annotation: MoxR family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF20030: bpMoxR" amino acids 6 to 208 (203 residues), 31.5 bits, see alignment E=3.4e-11 PF07726: AAA_3" amino acids 37 to 167 (131 residues), 205.1 bits, see alignment E=1.2e-64 PF07728: AAA_5" amino acids 43 to 165 (123 residues), 51.1 bits, see alignment E=5.3e-17 PF00004: AAA" amino acids 43 to 153 (111 residues), 30.3 bits, see alignment E=1.8e-10 PF17863: AAA_lid_2" amino acids 231 to 284 (54 residues), 53.5 bits, see alignment E=5.9e-18

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 99% identity to vap:Vapar_3377)

Predicted SEED Role

"FIG022979: MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>ABID97_RS19900 MoxR family ATPase (Variovorax sp. OAS795)
MDVAAKLATLLSQLNTVIVGKEPQVRDCVACLLAGGHLLIEDVPGVGKTTLAHALSHTFG
LQFSRVQFTADLMPGDLSGVAIYDRGQQAFVFHPGPIFAQVLLADEINRASPKTQSALLE
AMEEKQVTIEGETRPLPTPFFVIATQNPQDQLGTFALPESQLDRFLMRISLGYPDRAAER
ELLAGADRREMLATLPAMLTAGELTALQQRVQQVHAAEPLLNYVQDLIAATRSGRWFLQG
LSPRAGIAVLRAAKAQALLANRSYVAPDDVQSILPQTVAHRLTPVGDAGRGAVEQVRAMI
ADVPLP