Protein Info for ABID97_RS19705 in Variovorax sp. OAS795

Annotation: carboxymuconolactone decarboxylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02627: CMD
  • amino acids 43 to 129 (87 residues), 49.6 bits, E=1.6e-17

Best Hits

KEGG orthology group: K01607, 4-carboxymuconolactone decarboxylase [EC: 4.1.1.44] (inferred from 91% identity to vap:Vapar_3323)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase (EC 4.1.1.44)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 4.1.1.44)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (8/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (25/35 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of aerobic toluene degradation (16/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Protein Sequence (143 amino acids)

>ABID97_RS19705 carboxymuconolactone decarboxylase family protein (Variovorax sp. OAS795)
MTDQQPGTPPANDYEAGLVNRRRVLGDPWVDKSLANRNEFNAEFQELITRHAWNDIWGRP
ALGDKTRRYMVLSMMLGIHAYEEFAMHVRAALDGPPESRLTPDDIKEVIMMAAIYCGVPV
ANHAFGIATSILREKGLLPAAGK