Protein Info for ABID97_RS19635 in Variovorax sp. OAS795

Annotation: TRAP transporter large permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 28 to 28 (1 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 84 to 125 (42 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 310 to 327 (18 residues), see Phobius details amino acids 333 to 350 (18 residues), see Phobius details amino acids 356 to 379 (24 residues), see Phobius details amino acids 390 to 414 (25 residues), see Phobius details PF06808: DctM" amino acids 7 to 414 (408 residues), 409.7 bits, see alignment E=6.8e-127 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 418 (402 residues), 447.7 bits, see alignment E=1.7e-138

Best Hits

KEGG orthology group: None (inferred from 98% identity to vap:Vapar_3297)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>ABID97_RS19635 TRAP transporter large permease (Variovorax sp. OAS795)
MTPVMVATMVLCFALSVSVAVSIGLASILGIQVANVNMLISVKEMFNSINKFPLAAIPFF
ILAGNLMETGGISRRLVEFAKSIVGGVQGGLPMTCVLTCMIFAAVSGSSVATTFAIGAIL
IPALIKHGYPTAYAAALQATSAELGVIIPPSIPMILYGVSAEVSIGELFIAGFGPGILIS
LALMLFVWVYCKWRGWGKNDGEGRMPFGKAAWQAGWALLMPVIILGGIYGGIFTPTEASA
VAVFYALVVGVVIYREIKPKDLYLILRKSVLSSAVIMFIIANAGLFAFLITRAGVPDAIG
HWLQEVLKSPAMFLLGVNAALFIIGMFIETSAAIIVLAPILAPVAVHFGIDPVHFGLIMV
VNLALGMITPPFGVNLFAACTVARISLDRIVTYLVPFVLVILACLMVITYVPWISLALRD
LVYAK