Protein Info for ABID97_RS19610 in Variovorax sp. OAS795

Annotation: putative hydro-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF07286: D-Glu_cyclase" amino acids 120 to 262 (143 residues), 228.1 bits, see alignment E=1.7e-72

Best Hits

Swiss-Prot: 70% identical to Y1776_POLSJ: Putative hydro-lyase Bpro_1776 (Bpro_1776) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: None (inferred from 89% identity to vap:Vapar_3292)

Predicted SEED Role

"hypothetical protein possibly connected to lactam utilization and allophanate hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>ABID97_RS19610 putative hydro-lyase (Variovorax sp. OAS795)
MSNRPSFVEQPGAGSSALDVRHACRNGSLSSHTSGLANAHVQGNLVILPKAHSIDFLRFC
KANPKPCPLLGVSEAGDPAMPALGDDIDIRSDLPRYRVWRDGVLVDEPTDIRALWTGDLV
SFVIGCSFTFEHALMAEGIPLRHVEQGRNVAMYRTTVATTPAGPFHGPMVVSMRPLRAVD
AIRAVQITSRFPAVHGAPVHIGDPELIGIRSIADPDYGDSVEVMPDEVPVFWACGVTPQA
ALAAARLPFAITHAPGSMLVTDLLHHSLAAF