Protein Info for ABID97_RS19155 in Variovorax sp. OAS795

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details amino acids 322 to 339 (18 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 383 to 410 (28 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 76% identity to vap:Vapar_3197)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>ABID97_RS19155 polysaccharide biosynthesis protein (Variovorax sp. OAS795)
MNPLHRTFGLAGARTLQLRGLGALASRLYVYLSGFLAVFLMAAYVSPADFGQYSIYQSVL
EVALVVGTLGSALLFSRHAASVPPGVRRGDVVRTLAIGLPLATLLVAAILTLQRTAVADL
PFVLVVATLAVFAFVSLRLSYSRGLGYAGLLNLEAGIRSTILVLGVAGLSLLGLELHVTH
LLLINLLALLVVAAACMHTGWAAGPPRGGPALGLASQGSATVYAILMFLLRKSDLLVVAF
FMPLGYVGAFKIAFLLAEAPSQFVQAFLYTKTRAMLGSDASNFDDSQLQLAKHSFLLGCV
LFAGLAVVITVAAPLLKVGREALEIFLCIAPYFLVRTYTVHHEMLLALKTPMSTLGYWAL
AEVALRLVSYGVVVSVVPDKPHYVFFIAAFSELLLYEVRMHALLGFFPLVRLIRGSSTKQ
S