Protein Info for ABID97_RS18125 in Variovorax sp. OAS795

Annotation: D-amino acid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 48 to 69 (22 residues), see Phobius details PF01262: AlaDh_PNT_C" amino acids 27 to 84 (58 residues), 25.3 bits, see alignment 3.3e-09 PF00070: Pyr_redox" amino acids 53 to 86 (34 residues), 27.5 bits, see alignment 1.3e-09 PF01266: DAO" amino acids 53 to 448 (396 residues), 275.8 bits, see alignment E=2.6e-85 PF02558: ApbA" amino acids 53 to 84 (32 residues), 25.1 bits, see alignment (E = 4.3e-09) PF13450: NAD_binding_8" amino acids 55 to 88 (34 residues), 26.9 bits, see alignment 1.7e-09

Best Hits

Swiss-Prot: 68% identical to DADA_BRADU: D-amino acid dehydrogenase (dadA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 93% identity to vap:Vapar_3174)

MetaCyc: 58% identical to D-amino acid dehydrogenase (Escherichia coli K-12 substr. MG1655)
RXN-11193 [EC: 1.4.5.1]; 1.4.5.- [EC: 1.4.5.1]

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.5.1 or 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>ABID97_RS18125 D-amino acid dehydrogenase (Variovorax sp. OAS795)
MLGSPRCSKTGRASPGPGRHGNCKTHSAFSAQEPVPSRAIAVRGIQGVVLMQVLILGSGV
IGTSVAYYLTRAGHDVTVLERQPAPALETSFGNAGEVSPGYSAPWAGPGVPLKAVKWMLM
QHSPLVVKPMLDPAMWRWGLSMLRNCTQARYELNKGRMVRLAEYSRDCLKALRADTGIRY
DERALGTLQLFRTQKQLDGIAKDVEVLKASGVPYQVLDREGCVRYEPALAAVRQKFVGGL
RLPGDETGDCFKFTQALAVMAEAAGAKFRFGVGIQAIERDAGGVIGVRTDAGRFTSERYV
VALGSYSPAMVKPLGIDLPVYPVKGFSITVPISDAAGAPESTVMDETYKVAVTRLGDRIR
VGGTAELSGFDLRLDAARRGTLEHVVTDLFPKGGDVREASFWTGLRPMTPDGTPVIGATR
IPNLMLCTGHGTLGWTMAAGTGRVMADLIGGRPPEIDMEGLTVARYGA