Protein Info for ABID97_RS18030 in Variovorax sp. OAS795

Annotation: tRNA (guanosine(46)-N7)-methyltransferase TrmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR00091: tRNA (guanine-N(7)-)-methyltransferase" amino acids 67 to 248 (182 residues), 172.4 bits, see alignment E=3.5e-55 PF02390: Methyltransf_4" amino acids 77 to 244 (168 residues), 186.5 bits, see alignment E=1.5e-59

Best Hits

Swiss-Prot: 71% identical to TRMB_ACISJ: tRNA (guanine-N(7)-)-methyltransferase (trmB) from Acidovorax sp. (strain JS42)

KEGG orthology group: K03439, tRNA (guanine-N7-)-methyltransferase [EC: 2.1.1.33] (inferred from 89% identity to vpe:Varpa_3550)

MetaCyc: 51% identical to tRNA m7G46 methyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA (guanine-N(7)-)-methyltransferase. [EC: 2.1.1.33]

Predicted SEED Role

"tRNA (guanine46-N7-)-methyltransferase (EC 2.1.1.33)" (EC 2.1.1.33)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>ABID97_RS18030 tRNA (guanosine(46)-N7)-methyltransferase TrmB (Variovorax sp. OAS795)
MTSSDTVPHDLPPSDDNAGDDDNKPHPLHRRLKSFVKRAGRTTDGQARAFAELGPLFLIP
YRPEPLDLTAAFGGRVAPTVLEIGFGMGEATAHIATVMPETHFLCCEVHEPGVGALLKRI
GEQSITNIRICAHDAVDVLDHMLQPDSLAGVHVFFPDPWHKKRHNKRRLIQPGFVKKLAE
HLRPGGYIHCATDWQPYAEQMLEVLSAEPLLRNTAEGYAPKPAYRPLTKFENRGLKLGHG
VWDLVFQRA