Protein Info for ABID97_RS18005 in Variovorax sp. OAS795

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 18 to 45 (28 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details PF07291: MauE" amino acids 14 to 97 (84 residues), 29.5 bits, see alignment E=1.2e-10 PF07681: DoxX" amino acids 17 to 98 (82 residues), 70.2 bits, see alignment E=2.8e-23 PF02077: SURF4" amino acids 61 to 135 (75 residues), 49 bits, see alignment E=1e-16

Best Hits

Swiss-Prot: 41% identical to YPHA_SHIFL: Inner membrane protein YphA (yphA) from Shigella flexneri

KEGG orthology group: None (inferred from 78% identity to vap:Vapar_3122)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>ABID97_RS18005 DoxX family protein (Variovorax sp. OAS795)
MANTTTHPFNAAQDALALVGRILIATLFIPAGFGKLMGFAGTVGYITKATGLPLPEVGAA
IAIIVELGLGIALLVGFKTRWTALIMAVFTVATALFFHKFWVDATQNIQFFKNMSIAGGL
LAFAAFGPGRFSIDKR