Protein Info for ABID97_RS17850 in Variovorax sp. OAS795

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13432: TPR_16" amino acids 32 to 90 (59 residues), 33.8 bits, see alignment E=2e-11 amino acids 99 to 140 (42 residues), 27.7 bits, see alignment 1.6e-09 PF13174: TPR_6" amino acids 63 to 91 (29 residues), 16.8 bits, see alignment 4.3e-06 amino acids 99 to 125 (27 residues), 15.1 bits, see alignment (E = 1.5e-05) PF14559: TPR_19" amino acids 70 to 129 (60 residues), 29.8 bits, see alignment E=3.1e-10 PF13181: TPR_8" amino acids 94 to 126 (33 residues), 24.5 bits, see alignment 1.1e-08 PF07719: TPR_2" amino acids 94 to 126 (33 residues), 29.8 bits, see alignment 2.1e-10 PF00515: TPR_1" amino acids 95 to 126 (32 residues), 33.4 bits, see alignment 1.4e-11 PF13428: TPR_14" amino acids 96 to 135 (40 residues), 26.1 bits, see alignment 4.9e-09 PF13414: TPR_11" amino acids 103 to 140 (38 residues), 40.1 bits, see alignment 1.1e-13

Best Hits

KEGG orthology group: None (inferred from 93% identity to vap:Vapar_3091)

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>ABID97_RS17850 tetratricopeptide repeat protein (Variovorax sp. OAS795)
MKHVAFPKLSIAFALLFSLWGSAAYANDYDDVNALLRQGKPNEALAKADAYIAGKPRDPQ
MRFLRGVILTEQKKQNEAIAAFTQLTQDFPELPEPYNNLAALYAAQSKFDQARAALEQAL
KLNPNYATAHENLGDVYARLAAQEYVRAQQFASTNASVGPKLTLLREIFTPKTQADAAVL
PAAPPEVRKPVGRASK