Protein Info for ABID97_RS17845 in Variovorax sp. OAS795

Annotation: cysteine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 TIGR00435: cysteine--tRNA ligase" amino acids 3 to 455 (453 residues), 537.4 bits, see alignment E=1.9e-165 PF01406: tRNA-synt_1e" amino acids 16 to 317 (302 residues), 431.3 bits, see alignment E=5.6e-133 PF09334: tRNA-synt_1g" amino acids 253 to 301 (49 residues), 23.7 bits, see alignment 4.8e-09 PF00133: tRNA-synt_1" amino acids 259 to 307 (49 residues), 24.3 bits, see alignment 3.1e-09 PF09190: DALR_2" amino acids 346 to 401 (56 residues), 48.7 bits, see alignment 2.3e-16

Best Hits

Swiss-Prot: 93% identical to SYC_VARPS: Cysteine--tRNA ligase (cysS) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 93% identity to vap:Vapar_3090)

MetaCyc: 53% identical to cysteine--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Cysteine--tRNA ligase. [EC: 6.1.1.16]

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>ABID97_RS17845 cysteine--tRNA ligase (Variovorax sp. OAS795)
MSLRIYNTLSRELEEFSPLQAGKVRMYVCGMTVYDLCHLGHARSMIGFDLVQRWLKSSGY
EVNYVRNITDIDDKIIRRAVENGETIRSLTDRMIDALHEDADALGIARPTHEPRATDYIP
QMLSMIGTLEQKGLAYRSGNGDVNYAIRKFPGYGKLSGKSIDELHAGERVAVLDGKDDPL
DPVLWKSAKASEPDEVKWASEFGPGRPGWHIECSAMACELLGETLDIHGGGEDLQFPHHE
NEIAQSEGATGKPLANYWMHNGFIVTDNEKMSKSLGNFFLIRDVLKKYDAETIRFFVVRA
HYRRPLNYSDVHLDDARNSLKRLYTALDLVAPADVGIDWSDPYAARFKAAMDEDLATPEA
VAVLFDLAGEVNRTRSAAQAGLLKALGGCLNILQSDPTGFLRAGATLDEATIQARIDARA
AAKAAKNFAEADRIRADLLAEGIVLKDSPTGTTWAAAQ