Protein Info for ABID97_RS17830 in Variovorax sp. OAS795

Annotation: tRNA lysidine(34) synthetase TilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 19 to 203 (185 residues), 159 bits, see alignment E=6.7e-51 PF01171: ATP_bind_3" amino acids 20 to 199 (180 residues), 171.2 bits, see alignment E=1.9e-54 PF09179: TilS" amino acids 249 to 310 (62 residues), 51.2 bits, see alignment E=1.2e-17

Best Hits

Swiss-Prot: 66% identical to TILS_POLNA: tRNA(Ile)-lysidine synthase (tilS) from Polaromonas naphthalenivorans (strain CJ2)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 90% identity to vap:Vapar_3087)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>ABID97_RS17830 tRNA lysidine(34) synthetase TilS (Variovorax sp. OAS795)
MNEAFERAMAAFEPAHLPLAVGFSGGADSTALLAACASVWPGQVVAFHVHHGLQAAADDF
ERHCAEVCERLGVPLVVHRVDARHAPGDSPEDAARRARYQAFATMARAGAAGGAIQSVAL
GHHADDQVETLLLALSRGAGLPGLASMPACARRHGLDLYRPLLAVPGADIRAWLKDLDLP
WIEDPTNENERYTRNRIRAVLLPALARTFPQFRTTFARSIGHAAQAQELLGELAAQDLAA
VGDPPRTGALQALSRARQANVLRHWLMQAHGCAPSAAQLDQLLDQVRACTTRGHRIHLKV
GNGFIERRGDFLHWYNYGPSPKASR