Protein Info for ABID97_RS17755 in Variovorax sp. OAS795

Annotation: PPK2 family polyphosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03709: polyphosphate:nucleotide phosphotransferase, PPK2 family
  • amino acids 6 to 263 (258 residues), 341.5 bits, E=1.5e-106
• PF03976: PPK2
  • amino acids 34 to 255 (222 residues), 234.1 bits, E=7.9e-74

Best Hits

Swiss-Prot: 49% identical to PK23_MEIRD: Polyphosphate:AMP/ADP phosphotransferase (K649_10090) from Meiothermus ruber (strain ATCC 35948 / DSM 1279 / VKM B-1258 / 21)

KEGG orthology group: None (inferred from 90% identity to vap:Vapar_3014)

Predicted SEED Role

"UDP-galactose-lipid carrier transferase (EC 2.-.-.-)" (EC 2.-.-.-)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Protein Sequence (269 amino acids)

>ABID97_RS17755 PPK2 family polyphosphate kinase (Variovorax sp. OAS795)
MASLKKYRVDDSKFKLSQVNPGETPFLDGNEAAQVAEIDALAGELDEMQDLLHAEGRRKV
LLVLQGMDTSGKDGTVRWVFSRTSPLGVRVTAFKAPSEDERARDYLWRCHAVVPRAGEIA
VWNRSHYEDVLVPVVEGWIDKAESKRRYAQINDFERLLVETGTVIVKCMLHIDKDEQRER
LQARIDTPGKQWKFSMGDLEVRTKWNAYQDAYGKALRATSTAHAPWYVIPANHKRHRNLM
IAKLLMKTLRDMKLEAPPADPALKGMIIK