Protein Info for ABID97_RS17680 in Variovorax sp. OAS795

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 97 to 122 (26 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 224 to 249 (26 residues), see Phobius details amino acids 261 to 287 (27 residues), see Phobius details amino acids 294 to 316 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 36 to 314 (279 residues), 112.9 bits, see alignment E=8e-37

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 98% identity to vpe:Varpa_3440)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>ABID97_RS17680 branched-chain amino acid ABC transporter permease (Variovorax sp. OAS795)
MKALDFDWKPLLLAPILAAVALPLTGSFSTWLTLTVAGLAMGMIIFIIASGLTLVFGLMD
VLNFGHGVFIALGAFVASSVLGLMGDWTGSGELWRNLVAVFPAMLVAMAVAGAVGLAFER
FIVRPVYGQHLKQILITMGGMIIGEELIKVIWGPAQVPLPLPEALRGSLLIGDAAISKYR
LLAVAVGIVVFGLLAWTLGRTKIGLLIRAGVQDREMVESLGYRIGRLFVGVFVVGSALAG
LGGVMWGLFQQNLVPQMGAQVNVLIFIVIIIGGLGSTGGALIGALLVGLMTNYIGFLLPT
LTQFASILLMVAVLLWRPQGVYPVANR