Protein Info for ABID97_RS17360 in Variovorax sp. OAS795

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF20434: BD-FAE" amino acids 42 to 143 (102 residues), 43.2 bits, see alignment E=3.5e-15 PF07859: Abhydrolase_3" amino acids 52 to 250 (199 residues), 168.1 bits, see alignment E=2.3e-53

Best Hits

KEGG orthology group: None (inferred from 96% identity to vap:Vapar_2561)

Predicted SEED Role

"Esterase/lipase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>ABID97_RS17360 alpha/beta hydrolase (Variovorax sp. OAS795)
MSPRPSSRSAEAAALAAAEGVEADLSIELPGRDPVDARVYGQRPRGETVPLVLHFHGGTF
VCGNLDNGRNVARLLAGAGAVVVSVAYPLAPESPFPEPIEVGYAALEWLYKQRVKLGGKG
ARVYLAGEEAGGNLAAGVALIARDRAHPPLAGQILLSPMLDPCAGTASLRKATSDEAECR
WAKGWEKYLSCPSNAMHPYAVPSGSLRLSSLAPALVLVGADDAMRDEAMTFAGRLRAAGI
EVTSSVLPGAANWPKALYDPEPSGCKACEASVQQHFREFFSATTPPPAAPKPS