Protein Info for ABID97_RS17310 in Variovorax sp. OAS795

Annotation: PLP-dependent aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00155: Aminotran_1_2
  • amino acids 41 to 391 (351 residues), 145 bits, E=5.2e-46
• PF01041: DegT_DnrJ_EryC1
  • amino acids 104 to 200 (97 residues), 20.9 bits, E=2.9e-08
• PF12897: Asp_aminotransf
  • amino acids 114 to 388 (275 residues), 41.4 bits, E=1.3e-14

Best Hits

KEGG orthology group: None (inferred from 95% identity to vpe:Varpa_3351)

Predicted SEED Role

"Aromatic-amino-acid aminotransferase (EC 2.6.1.57)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 2.6.1.57)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• L-tyrosine degradation I (5/5 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
• 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
• L-phenylalanine degradation II (anaerobic) (2/3 steps found)
• L-tyrosine degradation II (1/2 steps found)
• atromentin biosynthesis (1/2 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• superpathway of chorismate metabolism (40/59 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (4/9 steps found)
• 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
• L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
• L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
• rosmarinic acid biosynthesis I (3/10 steps found)
• superpathway of rosmarinic acid biosynthesis (4/14 steps found)
• (S)-reticuline biosynthesis I (1/11 steps found)
• tropane alkaloids biosynthesis (1/11 steps found)
• superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (4/16 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (7/27 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Lysine biosynthesis
• Methionine metabolism
• Novobiocin biosynthesis
• Phenylalanine metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.57

Use Curated BLAST to search for 2.6.1.57

Protein Sequence (395 amino acids)

>ABID97_RS17310 PLP-dependent aminotransferase family protein (Variovorax sp. OAS795)
MQFASRLDNVETSAIRELFKLLGKPGIISFAGGFPDSAMFDVEGLKEASQKALTDEPGGA
LQYGATEGYEPLRAQLSAFMKTKGVDVEPGGLIVTTGSQQALDLLGKTMISPGDKVIVEG
PTFLATIQCFRLYGAELISAPIDANGVKTDELEKLIAEHKPKFVYLIPTFGNPSGAMLTL
ERRKKVLELAVKYQTLIVEDDPYGDLYFGEAPPPSIMALSKDVPGSRELLAHCGSLSKVL
SPGLRIGWMIAPAELLAKATMCKQFSDAHTSTFAQATAAQYLKSGRMPGTLAHVREVYGQ
RAQAMGAALKRELGDAVSFTQPQGGLFFWARLTGANGKLADAGELAKRAIEQLVAFVPGA
PFYAEKPDLSTLRLSFATADVAKIEEGVKRLGQAL