Protein Info for ABID97_RS17190 in Variovorax sp. OAS795

Annotation: NAD(P)H-hydrate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 TIGR00197: YjeF family N-terminal domain" amino acids 26 to 211 (186 residues), 99.8 bits, see alignment E=1.6e-32 PF03853: YjeF_N" amino acids 31 to 192 (162 residues), 118.8 bits, see alignment E=2.6e-38 TIGR00196: YjeF family C-terminal domain" amino acids 229 to 474 (246 residues), 169.6 bits, see alignment E=9.3e-54 PF01256: Carb_kinase" amino acids 244 to 476 (233 residues), 158.9 bits, see alignment E=1.6e-50

Best Hits

KEGG orthology group: None (inferred from 85% identity to vpe:Varpa_3331)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>ABID97_RS17190 NAD(P)H-hydrate dehydratase (Variovorax sp. OAS795)
MHRITSATVAHLFDIAATRRIEQAAAALPAHTLMQRAGLAVARLAMAIAPHARTVWIACG
PGNNGGDGFEAAAQLQRRGFRPVVTFAGDEDRLPPDAKASLQRAREASVIFAGNPPADYQ
LAIDALLGIGSTRPPEGAMAEWLHAMDASGQSVLGVDVPSGLNADTGVLSGDIGAHADTA
RFCVTFLTLKPGLFTAHGRDAAGTVWFDDLGCGGTAEPPVARLLGAAASTPRSHASHKGS
YGDVAVIGGAPGMAGAALLAGSAALHAGAGRVFVGLLDPGAAAVDPAQPELMLRHADALD
LSGMTAVCGCGGGAEVREALPRVLATAAALVLDADALNAIAADTGLQAQLASRARRAKPT
VITPHPLEAARLLNCTVADIQANRLAAARELAARYGAVAVLKGSGTVIAHDRGAPPVLNL
SGNARLATAGTGDVLAGMIGAALAMQKPAFEAACEAVWRHGRLADTWPANAAPLTAGALA
RQAP