Protein Info for ABID97_RS17050 in Variovorax sp. OAS795

Annotation: RlmE family RNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF01728: FtsJ" amino acids 32 to 215 (184 residues), 181.6 bits, see alignment E=7.2e-58

Best Hits

Swiss-Prot: 98% identical to RLME_VARPS: Ribosomal RNA large subunit methyltransferase E (rlmE) from Variovorax paradoxus (strain S110)

KEGG orthology group: K02427, ribosomal RNA large subunit methyltransferase E [EC: 2.1.1.-] (inferred from 98% identity to vap:Vapar_2623)

Predicted SEED Role

"Heat shock protein FtsJ/RrmJ @ Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>ABID97_RS17050 RlmE family RNA methyltransferase (Variovorax sp. OAS795)
MSTKAKSKKVNKAWLHDHINDPYVKLATREGYRARAAYKLKEIDESLGLVKPGQLVVDLG
STPGAWSQYLRRRMSPAGAAAGELNGTIVALDMLPMEPIEGVTFLQGDFREAALLEQVLG
VLAGRKADLVVSDMAPNLSGIHSADAARVAHLIELAIDFSQHHLKPEGALVAKLFHGSGY
DELVKLFKANFRTVKPFKPKASRDKSSETFLVGMGLKAQETP