Protein Info for ABID97_RS16945 in Variovorax sp. OAS795

Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 PF13742: tRNA_anti_2" amino acids 16 to 107 (92 residues), 96.8 bits, see alignment E=1.1e-31 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 17 to 423 (407 residues), 430 bits, see alignment E=4.7e-133 PF01336: tRNA_anti-codon" amino acids 35 to 108 (74 residues), 47.4 bits, see alignment E=2.3e-16 PF02601: Exonuc_VII_L" amino acids 131 to 421 (291 residues), 306.3 bits, see alignment E=4.7e-95

Best Hits

Swiss-Prot: 65% identical to EX7L_DELAS: Exodeoxyribonuclease 7 large subunit (xseA) from Delftia acidovorans (strain DSM 14801 / SPH-1)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 89% identity to vap:Vapar_2644)

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>ABID97_RS16945 exodeoxyribonuclease VII large subunit (Variovorax sp. OAS795)
MTIRDSHTTPGPRVWPVGALCRAVAGALDARFNPVAVRGEISGFSRASSGHCYFALKDDS
GQLRCAMFRRAAGLLDFSPRDGDQVEVRGRLAVYEPRGDLQLVVESLQRAGQGALFDQFL
QRKARLEAEGLFDPARKRPLPAMPRAVGLVTSLGAAALHDVVTALRRRVPHIPVILAPAA
VQGAGAPAEIVRALQSLYALEPAVDVILLVRGGGSIEDLWAFNDETLARTIVQSPVPLIC
GVGHETDFTIADFCADLRAPTPTAAAELVSAPQAMWLGAIDLLADRLEGALGTRLDALGQ
RLDQAAARLGRPSALVARQQLRLAHQTQRLRYAVLSRTQHLAHVPRSISADFPRKLERAL
TGRRERLERVALRLKLLDPALVLQRGYALLTDADGHAVVSAQKLNPGDAVVARLADGSVD
LTVMPGKSGTRPTPGP