Protein Info for ABID97_RS16875 in Variovorax sp. OAS795

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 16 to 284 (269 residues), 124.5 bits, see alignment E=2.3e-40

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 97% identity to vpe:Varpa_3253)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>ABID97_RS16875 ABC transporter permease (Variovorax sp. OAS795)
MTDLLDILANPAFWVAVLRIATPLILGTLGVLLCERTGVLNLGIEGIMVAGAFTGWLAVY
AGAPLWAGVGVAALTGMMFGLLHAFLTVGLALSQHVSGLGITLLATALSYFGYRVSFPKV
NTPPTIVPFAPMEWLPVPILNAQTSLTLFALLLVPAIAWVLYRTPLGLALRMVGENPQAA
ESQGVSVAATRTGAIVAGSALMGVAGSFLTLSAFNAFFFNMVNGRGWICVALVVFASWRP
GKALLGALLFAFFDALQLRLQQSGDAVLPYQIYLMLPYLLSILALVLVARKASYPQALMK
PYRKGER